Welcome to DBS-PSSM (Version 3; December 2007 update):
Prediction of DNA-binding residues by evolutionary profile and neural networks.


----------Current update: sensitivity 76%, specificity 76% Correlation 0.398--------------
----------Adjust sensitivity and specificity by post-prediction choice of real-to-binary cutoffs. --------------
----------For a large scale prediction of hundreds of sequences, please contact me by clicking here. --------------
Version 2 has been uploaded on September 1, 2007.
Version 3 has been uploaded on December 7, 2007 (some changes in the interface are still being carried out). Changes in version 3 can be found here

Please enter your sequence in a single letter code.

A test sequence is provided below. Copy the sequence and paste in the above text box to see how dbs-pssm works.
MSDIEEGTPTNNGQQKERRKIEIKFIENKTRRHVTFS KRKHGIMKKAFELSVLTGTQVLL LVVSETGLVYTFSTPKFEPIVTQQEGRNLIQACLNAPDDE

Please cite:
PSSM based prediction of DNA-binding sites in proteins,
Shandar Ahmad and Akinori Sarai BMC Bioinformatics2005, 6:33
Read the Article
Comments and feedback to: shandar@netasa.org