This web server predicts the mononucleotide and dinucleotide base step contacts in protein using evolutionary information in the form of PSSM using Neural Networks. The input is an amino acid sequence in the fasta format.

Enter your sequence below in plain text (FASTA format)

Test Sequence

Copy and paste the sequence in the text box above and press the predict button to see an example of prediction using evolutionary infomation (PSSM)

ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC NPRFNAHGDVNTIVCNSKDAGAWGAEQRESAFPFQPGSVVEN FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKCVAFE

Menu

• • Introduction
  • Sample Output
  • Server Performance
  • Dataset

Citation

When using this webserver please cite:

Andrabi M, Mizuguchi K, Sarai A, Ahmad S: Prediction of mono- and di- nucleotide specific DNA-binding sites in proteins using neural networks . BMC Structural biology,2009,9:30. PDF