Prediction Results are written below in the form of scores for all combinations of all amino-acid residues in the uploaded sequence (row names) with 16-possible dinucleotides (column names) .
(All scores are on a 0 to 1 scale.

Scores in the table are obtained by converting raw scores into the expected precision at the cutoff equal to that raw score and hence estimate the probability of that amino-acid-dinucleotide contact. Scores greater than 0.05 (5% probaility of contact) are highlighted by red color.

res#	res	AA	AC	AG	AU	CA	CC	CG	CU	GA	GC	GG	GU	UA	UC	UG	UU
1	M	0.024	0.043	0.047	0.022	0.020	0.029	0.029	0.030	0.048	0.033	0.034	0.034	0.025	0.026	0.030	0.008
2	G	0.103	0.064	0.109	0.034	0.085	0.090	0.117	0.059	0.113	0.086	0.117	0.060	0.047	0.061	0.089	0.015
3	R	0.055	0.080	0.123	0.042	0.047	0.065	0.071	0.077	0.110	0.094	0.094	0.069	0.049	0.063	0.074	0.011
4	G	0.043	0.021	0.021	0.014	0.038	0.052	0.046	0.028	0.041	0.032	0.017	0.038	0.009	0.025	0.025	0.009
5	K	0.045	0.072	0.095	0.036	0.039	0.056	0.058	0.066	0.092	0.080	0.080	0.062	0.047	0.053	0.062	0.009
6	V	0.011	0.012	0.008	0.006	0.008	0.011	0.010	0.004	0.012	0.005	0.007	0.008	0.007	0.005	0.008	0.007
7	K	0.039	0.040	0.031	0.018	0.034	0.045	0.044	0.03	0.048	0.040	0.055	0.036	0.037	0.027	0.040	0.007
8	P	0.010	0.014	0.009	0.009	0.014	0.017	0.012	0.010	0.012	0.016	0.017	0.014	0.012	0.011	0.011	0.007
9	N	0.063	0.049	0.045	0.022	0.048	0.066	0.065	0.041	0.074	0.050	0.063	0.051	0.040	0.037	0.054	0.008
10	R	0.065	0.078	0.183	0.036	0.062	0.086	0.108	0.079	0.135	0.136	0.138	0.077	0.044	0.064	0.093	0.021
11	K	0.101	0.054	0.074	0.019	0.073	0.114	0.134	0.061	0.123	0.088	0.078	0.079	0.031	0.043	0.081	0.013
12	S	0.081	0.056	0.094	0.035	0.072	0.074	0.091	0.053	0.092	0.074	0.091	0.052	0.038	0.057	0.071	0.014
13	T	0.012	0.026	0.024	0.026	0.016	0.018	0.013	0.023	0.022	0.025	0.019	0.022	0.015	0.026	0.015	0.006
14	G	0.050	0.040	0.054	0.029	0.049	0.049	0.053	0.036	0.055	0.049	0.056	0.036	0.028	0.041	0.044	0.011
15	D	0.043	0.030	0.045	0.027	0.047	0.042	0.044	0.027	0.041	0.040	0.044	0.028	0.020	0.037	0.034	0.013
16	N	0.067	0.043	0.069	0.031	0.063	0.060	0.071	0.040	0.067	0.057	0.069	0.040	0.029	0.048	0.054	0.013
17	S	0.015	0.028	0.047	0.026	0.022	0.025	0.022	0.028	0.031	0.043	0.031	0.027	0.014	0.030	0.021	0.013
18	N	0.009	0.012	0.008	0.009	0.013	0.016	0.011	0.009	0.011	0.015	0.016	0.013	0.010	0.010	0.010	0.008
19	V	0.008	0.011	0.008	0.005	0.009	0.012	0.010	0.005	0.011	0.007	0.010	0.009	0.007	0.005	0.008	0.009
20	V	0.007	0.010	0.007	0.005	0.008	0.011	0.009	0.005	0.009	0.007	0.009	0.009	0.007	0.005	0.007	0.008
21	T	0.008	0.011	0.007	0.008	0.011	0.014	0.009	0.008	0.009	0.013	0.013	0.011	0.009	0.009	0.008	0.007
22	M	0.007	0.009	0.006	0.004	0.006	0.009	0.008	0.003	0.009	0.005	0.007	0.007	0.005	0.003	0.006	0.009
23	I	0.007	0.009	0.006	0.004	0.006	0.009	0.008	0.003	0.009	0.005	0.007	0.007	0.005	0.003	0.006	0.009
24	R	0.042	0.041	0.033	0.019	0.036	0.047	0.047	0.031	0.051	0.042	0.058	0.037	0.038	0.028	0.042	0.008
25	A	0.028	0.030	0.021	0.017	0.027	0.033	0.029	0.022	0.032	0.029	0.037	0.027	0.027	0.023	0.027	0.007
26	G	0.040	0.068	0.077	0.033	0.034	0.052	0.051	0.062	0.084	0.071	0.068	0.060	0.044	0.048	0.056	0.008
27	S	0.016	0.019	0.016	0.005	0.011	0.019	0.021	0.007	0.024	0.010	0.018	0.014	0.012	0.006	0.015	0.010
28	Y	0.058	0.032	0.026	0.027	0.035	0.064	0.029	0.025	0.059	0.018	0.018	0.054	0.022	0.038	0.022	0.011
29	P	0.013	0.015	0.014	0.012	0.019	0.020	0.016	0.012	0.015	0.021	0.021	0.015	0.011	0.015	0.013	0.011
30	K	0.054	0.047	0.047	0.022	0.047	0.057	0.061	0.037	0.064	0.052	0.071	0.043	0.040	0.035	0.052	0.009
31	V	0.007	0.010	0.007	0.004	0.006	0.009	0.008	0.003	0.009	0.005	0.007	0.007	0.005	0.004	0.006	0.009
32	N	0.036	0.037	0.028	0.018	0.032	0.042	0.039	0.027	0.043	0.037	0.050	0.034	0.034	0.026	0.036	0.007
33	P	0.011	0.014	0.008	0.012	0.015	0.015	0.011	0.010	0.011	0.014	0.014	0.013	0.011	0.013	0.010	0.006
34	T	0.014	0.016	0.010	0.014	0.018	0.018	0.013	0.012	0.014	0.015	0.017	0.015	0.014	0.016	0.013	0.006
35	P	0.007	0.019	0.019	0.016	0.011	0.015	0.010	0.017	0.016	0.024	0.018	0.019	0.012	0.017	0.012	0.008
36	T	0.008	0.011	0.007	0.008	0.011	0.013	0.009	0.007	0.010	0.011	0.012	0.011	0.009	0.008	0.008	0.007
37	W	0.018	0.022	0.024	0.024	0.020	0.030	0.012	0.012	0.025	0.016	0.030	0.024	0.025	0.024	0.013	0.019
38	V	0.029	0.019	0.029	0.011	0.021	0.021	0.027	0.009	0.028	0.010	0.016	0.014	0.009	0.013	0.017	0.013
39	R	0.035	0.045	0.037	0.018	0.035	0.050	0.041	0.036	0.057	0.048	0.062	0.042	0.036	0.029	0.047	0.009
40	A	0.010	0.012	0.008	0.006	0.009	0.011	0.010	0.005	0.011	0.005	0.008	0.008	0.007	0.006	0.008	0.007
41	I	0.011	0.012	0.008	0.006	0.009	0.011	0.010	0.005	0.012	0.005	0.008	0.008	0.007	0.006	0.008	0.007
42	P	0.008	0.011	0.007	0.009	0.012	0.014	0.009	0.008	0.009	0.014	0.014	0.012	0.010	0.009	0.008	0.007
43	F	0.007	0.009	0.006	0.004	0.006	0.009	0.008	0.003	0.009	0.005	0.007	0.007	0.005	0.003	0.006	0.009
44	E	0.009	0.012	0.009	0.010	0.013	0.015	0.011	0.009	0.011	0.015	0.015	0.013	0.010	0.011	0.010	0.008
45	V	0.007	0.010	0.007	0.004	0.007	0.010	0.008	0.004	0.009	0.006	0.008	0.008	0.006	0.004	0.006	0.008
46	S	0.012	0.015	0.009	0.014	0.016	0.016	0.011	0.011	0.012	0.014	0.014	0.013	0.012	0.014	0.011	0.006
47	V	0.007	0.009	0.007	0.004	0.006	0.009	0.008	0.003	0.009	0.005	0.007	0.007	0.005	0.003	0.006	0.009
48	Q	0.030	0.022	0.031	0.023	0.037	0.031	0.030	0.020	0.028	0.030	0.032	0.022	0.015	0.029	0.024	0.012
49	S	0.008	0.012	0.008	0.009	0.012	0.015	0.010	0.009	0.010	0.015	0.015	0.012	0.010	0.010	0.009	0.007
50	G	0.010	0.014	0.010	0.010	0.014	0.017	0.013	0.010	0.013	0.017	0.018	0.014	0.012	0.011	0.011	0.008
51	I	0.011	0.012	0.008	0.006	0.009	0.011	0.010	0.005	0.012	0.005	0.008	0.008	0.007	0.006	0.008	0.007
52	A	0.008	0.011	0.007	0.009	0.012	0.014	0.009	0.008	0.009	0.014	0.014	0.012	0.010	0.009	0.008	0.007
53	F	0.007	0.009	0.007	0.004	0.006	0.009	0.008	0.003	0.009	0.005	0.007	0.007	0.006	0.004	0.006	0.009
54	K	0.013	0.016	0.011	0.013	0.017	0.019	0.014	0.012	0.015	0.017	0.019	0.016	0.014	0.014	0.013	0.007
55	V	0.011	0.012	0.008	0.006	0.009	0.011	0.010	0.004	0.012	0.005	0.007	0.008	0.007	0.006	0.008	0.007
56	P	0.008	0.011	0.007	0.009	0.012	0.014	0.010	0.008	0.010	0.014	0.014	0.012	0.010	0.009	0.009	0.007
57	V	0.018	0.018	0.014	0.007	0.012	0.016	0.017	0.007	0.021	0.008	0.013	0.013	0.011	0.007	0.013	0.008
58	G	0.008	0.011	0.007	0.009	0.012	0.014	0.009	0.008	0.009	0.014	0.014	0.012	0.010	0.009	0.009	0.007
59	S	0.035	0.037	0.029	0.016	0.032	0.043	0.041	0.027	0.044	0.039	0.053	0.035	0.035	0.025	0.037	0.008
60	L	0.007	0.009	0.007	0.004	0.006	0.009	0.008	0.003	0.009	0.005	0.007	0.007	0.005	0.003	0.006	0.009
61	F	0.007	0.010	0.007	0.006	0.009	0.012	0.009	0.006	0.009	0.009	0.011	0.010	0.008	0.007	0.008	0.008
62	S	0.039	0.040	0.031	0.018	0.034	0.045	0.044	0.029	0.048	0.040	0.055	0.036	0.037	0.027	0.040	0.007
63	A	0.014	0.028	0.030	0.029	0.018	0.020	0.015	0.026	0.025	0.028	0.021	0.024	0.016	0.030	0.017	0.007
64	N	0.039	0.041	0.045	0.018	0.036	0.057	0.048	0.028	0.058	0.049	0.077	0.043	0.041	0.028	0.043	0.014
65	F	0.040	0.017	0.019	0.006	0.021	0.036	0.041	0.012	0.041	0.012	0.009	0.024	0.005	0.010	0.018	0.010
66	R	0.079	0.054	0.085	0.028	0.069	0.077	0.094	0.048	0.090	0.075	0.100	0.052	0.040	0.049	0.072	0.014
67	T	0.012	0.020	0.015	0.020	0.016	0.017	0.012	0.016	0.017	0.019	0.016	0.018	0.014	0.020	0.013	0.006
68	D	0.011	0.013	0.010	0.011	0.016	0.018	0.013	0.010	0.013	0.017	0.017	0.014	0.010	0.012	0.011	0.009
69	S	0.013	0.015	0.015	0.012	0.020	0.021	0.017	0.012	0.015	0.021	0.021	0.015	0.011	0.015	0.014	0.011
70	F	0.015	0.011	0.006	0.003	0.009	0.018	0.015	0.006	0.018	0.005	0.004	0.015	0.005	0.005	0.008	0.006
71	T	0.008	0.011	0.007	0.009	0.012	0.014	0.009	0.008	0.009	0.014	0.014	0.012	0.010	0.009	0.008	0.007
72	S	0.008	0.011	0.007	0.009	0.012	0.014	0.009	0.008	0.009	0.014	0.014	0.012	0.010	0.009	0.009	0.007
73	V	0.007	0.009	0.007	0.004	0.006	0.009	0.008	0.003	0.009	0.005	0.007	0.007	0.005	0.004	0.006	0.009
74	T	0.008	0.011	0.007	0.009	0.012	0.014	0.009	0.008	0.009	0.014	0.014	0.012	0.010	0.009	0.008	0.007
75	V	0.007	0.009	0.006	0.004	0.006	0.009	0.008	0.003	0.009	0.005	0.007	0.007	0.005	0.003	0.006	0.009
76	M	0.007	0.010	0.007	0.004	0.007	0.010	0.008	0.004	0.009	0.006	0.008	0.008	0.006	0.004	0.006	0.008
77	S	0.022	0.027	0.021	0.012	0.023	0.034	0.030	0.019	0.031	0.033	0.043	0.027	0.025	0.017	0.026	0.009
78	V	0.007	0.013	0.012	0.005	0.006	0.010	0.009	0.005	0.013	0.007	0.008	0.010	0.006	0.005	0.007	0.009
79	R	0.073	0.055	0.075	0.029	0.062	0.070	0.083	0.048	0.085	0.068	0.090	0.051	0.042	0.047	0.068	0.012
80	A	0.018	0.022	0.018	0.005	0.012	0.023	0.026	0.008	0.029	0.012	0.023	0.017	0.014	0.006	0.019	0.011
81	W	0.033	0.037	0.044	0.020	0.016	0.045	0.022	0.022	0.071	0.015	0.013	0.054	0.015	0.025	0.018	0.014
82	T	0.008	0.010	0.008	0.004	0.007	0.010	0.009	0.004	0.010	0.005	0.008	0.008	0.006	0.004	0.007	0.010
83	Q	0.015	0.024	0.038	0.022	0.022	0.025	0.021	0.024	0.027	0.038	0.029	0.024	0.013	0.026	0.020	0.013
84	L	0.011	0.012	0.008	0.006	0.009	0.011	0.010	0.004	0.012	0.005	0.007	0.008	0.007	0.006	0.008	0.007
85	T	0.011	0.012	0.008	0.007	0.009	0.011	0.010	0.005	0.012	0.005	0.008	0.009	0.007	0.006	0.008	0.007
86	P	0.008	0.011	0.007	0.009	0.012	0.014	0.009	0.008	0.009	0.014	0.014	0.012	0.010	0.009	0.008	0.007
87	P	0.032	0.033	0.025	0.017	0.030	0.038	0.034	0.025	0.038	0.033	0.044	0.030	0.030	0.024	0.032	0.007
88	V	0.011	0.012	0.008	0.006	0.009	0.011	0.010	0.005	0.012	0.005	0.008	0.008	0.007	0.006	0.008	0.007
89	N	0.039	0.040	0.030	0.018	0.034	0.045	0.043	0.029	0.047	0.040	0.055	0.036	0.037	0.027	0.040	0.007
90	E	0.022	0.018	0.027	0.017	0.030	0.029	0.027	0.017	0.024	0.030	0.031	0.019	0.012	0.022	0.020	0.015
91	Y	0.015	0.018	0.012	0.011	0.019	0.016	0.014	0.008	0.010	0.016	0.019	0.017	0.011	0.018	0.009	0.007
92	S	0.008	0.011	0.007	0.009	0.012	0.014	0.009	0.008	0.009	0.014	0.014	0.012	0.010	0.009	0.008	0.007
93	F	0.011	0.014	0.011	0.005	0.009	0.014	0.013	0.005	0.016	0.008	0.013	0.011	0.009	0.005	0.010	0.010
94	V	0.011	0.012	0.012	0.005	0.010	0.013	0.013	0.005	0.014	0.007	0.010	0.009	0.006	0.005	0.009	0.012
95	R	0.035	0.036	0.032	0.016	0.034	0.045	0.044	0.027	0.046	0.042	0.057	0.035	0.032	0.025	0.038	0.009
96	L	0.011	0.012	0.008	0.006	0.009	0.011	0.010	0.004	0.012	0.005	0.007	0.008	0.007	0.006	0.008	0.007
97	K	0.013	0.015	0.010	0.015	0.017	0.017	0.012	0.011	0.013	0.014	0.015	0.014	0.012	0.015	0.011	0.006
98	P	0.008	0.011	0.007	0.009	0.012	0.014	0.009	0.008	0.009	0.014	0.014	0.012	0.010	0.009	0.008	0.007
99	L	0.009	0.012	0.008	0.008	0.011	0.014	0.011	0.007	0.011	0.011	0.013	0.012	0.010	0.008	0.009	0.007
100	F	0.007	0.009	0.007	0.004	0.006	0.009	0.008	0.003	0.009	0.005	0.007	0.007	0.005	0.004	0.006	0.009
101	K	0.067	0.052	0.064	0.025	0.057	0.067	0.077	0.043	0.078	0.063	0.086	0.048	0.042	0.042	0.063	0.011
102	T	0.012	0.018	0.013	0.018	0.016	0.017	0.012	0.015	0.016	0.017	0.016	0.016	0.013	0.018	0.012	0.006
103	G	0.017	0.028	0.026	0.024	0.020	0.023	0.018	0.024	0.026	0.027	0.024	0.024	0.018	0.026	0.019	0.007
104	D	0.010	0.014	0.010	0.010	0.015	0.018	0.013	0.010	0.013	0.017	0.018	0.014	0.011	0.011	0.011	0.008
105	S	0.021	0.019	0.017	0.019	0.026	0.023	0.019	0.016	0.019	0.020	0.021	0.017	0.014	0.022	0.017	0.008
106	T	0.012	0.025	0.024	0.025	0.015	0.017	0.013	0.022	0.021	0.024	0.018	0.021	0.014	0.025	0.015	0.007
107	E	0.022	0.019	0.028	0.017	0.030	0.029	0.027	0.017	0.024	0.031	0.031	0.020	0.012	0.022	0.020	0.015
108	E	0.008	0.011	0.007	0.009	0.012	0.014	0.009	0.008	0.009	0.014	0.014	0.012	0.010	0.009	0.008	0.007
109	F	0.008	0.012	0.007	0.010	0.012	0.014	0.010	0.008	0.010	0.014	0.014	0.012	0.010	0.010	0.009	0.007
110	E	0.012	0.018	0.013	0.017	0.016	0.017	0.012	0.014	0.015	0.017	0.016	0.016	0.013	0.018	0.012	0.006
111	G	0.036	0.025	0.035	0.027	0.042	0.033	0.033	0.023	0.032	0.031	0.033	0.023	0.016	0.034	0.026	0.012
112	R	0.085	0.071	0.057	0.025	0.048	0.094	0.090	0.088	0.132	0.071	0.042	0.102	0.034	0.051	0.069	0.005
113	A	0.077	0.035	0.031	0.021	0.054	0.069	0.068	0.044	0.068	0.039	0.026	0.052	0.017	0.039	0.041	0.007
114	S	0.008	0.020	0.020	0.017	0.012	0.016	0.011	0.017	0.017	0.025	0.018	0.019	0.012	0.017	0.012	0.008
115	N	0.034	0.036	0.032	0.015	0.032	0.046	0.044	0.027	0.046	0.044	0.060	0.036	0.033	0.023	0.039	0.009
116	I	0.019	0.020	0.040	0.010	0.017	0.021	0.025	0.010	0.030	0.015	0.019	0.016	0.008	0.012	0.017	0.019
117	N	0.047	0.037	0.042	0.024	0.044	0.047	0.049	0.031	0.050	0.043	0.055	0.035	0.029	0.035	0.041	0.010
118	T	0.009	0.011	0.009	0.006	0.009	0.012	0.010	0.005	0.011	0.008	0.010	0.009	0.007	0.006	0.008	0.009
119	R	0.126	0.100	0.187	0.041	0.083	0.137	0.167	0.137	0.222	0.150	0.096	0.134	0.040	0.089	0.121	0.013
120	A	0.033	0.025	0.034	0.020	0.029	0.030	0.031	0.021	0.036	0.023	0.021	0.024	0.012	0.025	0.023	0.010

Sequences used in alignment to generate PSSM for prediction inputs are shown below


BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= Fasta generated from webin
         (120 letters)

Database: nr 
           12,478,334 sequences; 4,262,199,788 total letters

Searching..................................................done


Results from round 1


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

sp|P17574.1|COAT_STMV RecName: Full=Coat protein >gi|3212290|pdb...   244   2e-63

>sp|P17574.1|COAT_STMV RecName: Full=Coat protein
 pdb|1A34|A Chain A, Satellite Tobacco Mosaic VirusRNA COMPLEX
 gb|AAA47785.1| coat protein [Tobacco necrosis satellite virus]
          Length = 159

 Score =  244 bits (623), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 120/120 (100%), Positives = 120/120 (100%)

Query: 1   MGRGKVKPNRKSTGDNSNVVTMIRAGSYPKVNPTPTWVRAIPFEVSVQSGIAFKVPVGSL 60
           MGRGKVKPNRKSTGDNSNVVTMIRAGSYPKVNPTPTWVRAIPFEVSVQSGIAFKVPVGSL
Sbjct: 1   MGRGKVKPNRKSTGDNSNVVTMIRAGSYPKVNPTPTWVRAIPFEVSVQSGIAFKVPVGSL 60

Query: 61  FSANFRTDSFTSVTVMSVRAWTQLTPPVNEYSFVRLKPLFKTGDSTEEFEGRASNINTRA 120
           FSANFRTDSFTSVTVMSVRAWTQLTPPVNEYSFVRLKPLFKTGDSTEEFEGRASNINTRA
Sbjct: 61  FSANFRTDSFTSVTVMSVRAWTQLTPPVNEYSFVRLKPLFKTGDSTEEFEGRASNINTRA 120


Searching..................................................done


Results from round 2


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value
Sequences used in model and found again:

sp|P17574.1|COAT_STMV RecName: Full=Coat protein >gi|3212290|pdb...   242   9e-63

Sequences not found previously or not previously below threshold:


CONVERGED!
>sp|P17574.1|COAT_STMV RecName: Full=Coat protein
 pdb|1A34|A Chain A, Satellite Tobacco Mosaic VirusRNA COMPLEX
 gb|AAA47785.1| coat protein [Tobacco necrosis satellite virus]
          Length = 159

 Score =  242 bits (618), Expect = 9e-63,   Method: Composition-based stats.
 Identities = 120/120 (100%), Positives = 120/120 (100%)

Query: 1   MGRGKVKPNRKSTGDNSNVVTMIRAGSYPKVNPTPTWVRAIPFEVSVQSGIAFKVPVGSL 60
           MGRGKVKPNRKSTGDNSNVVTMIRAGSYPKVNPTPTWVRAIPFEVSVQSGIAFKVPVGSL
Sbjct: 1   MGRGKVKPNRKSTGDNSNVVTMIRAGSYPKVNPTPTWVRAIPFEVSVQSGIAFKVPVGSL 60

Query: 61  FSANFRTDSFTSVTVMSVRAWTQLTPPVNEYSFVRLKPLFKTGDSTEEFEGRASNINTRA 120
           FSANFRTDSFTSVTVMSVRAWTQLTPPVNEYSFVRLKPLFKTGDSTEEFEGRASNINTRA
Sbjct: 61  FSANFRTDSFTSVTVMSVRAWTQLTPPVNEYSFVRLKPLFKTGDSTEEFEGRASNINTRA 120


  Database: nr
    Posted date:  Dec 18, 2010 11:10 AM
  Number of letters in database: 999,999,605
  Number of sequences in database:  2,987,033
  
  Database: /data/bio/db/blast/nr.01
    Posted date:  Dec 18, 2010 11:14 AM
  Number of letters in database: 999,999,854
  Number of sequences in database:  2,892,470
  
  Database: /data/bio/db/blast/nr.02
    Posted date:  Dec 18, 2010 11:17 AM
  Number of letters in database: 999,999,815
  Number of sequences in database:  2,905,750
  
  Database: /data/bio/db/blast/nr.03
    Posted date:  Dec 18, 2010 11:21 AM
  Number of letters in database: 999,999,872
  Number of sequences in database:  2,925,914
  
  Database: /data/bio/db/blast/nr.04
    Posted date:  Dec 18, 2010 11:23 AM
  Number of letters in database: 262,200,642
  Number of sequences in database:  767,167
  
Lambda     K      H
   0.316    0.130    0.380 

Lambda     K      H
   0.267   0.0404    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,880,271,149
Number of Sequences: 12478334
Number of extensions: 64479289
Number of successful extensions: 108996
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 108992
Number of HSP's gapped (non-prelim): 8
length of query: 120
length of database: 4,262,199,788
effective HSP length: 87
effective length of query: 33
effective length of database: 3,176,584,730
effective search space: 104827296090
effective search space used: 104827296090
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 75 (33.5 bits)