Enter your sequence here for prediction using PSSM (slow but more accurate).


A test sequence is provided below

Copy the sequence, paste in the text box above and press the predict button to see an example of prediction using evolutionary information (PSSM).

ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLCLHFNPRFNAHGD
VNTIVCNSKDAGAWGAEQRESAFPFQPGSVVEVCISFNQTDLTIKLPDGYEFKF
PNRLNLEAINYLSAGGDFKIKCVAFE

Click Here to get a copy of data used in developing this prediction server.
Click Here to browser through the data.